The domain within your query sequence starts at position 1 and ends at position 53; the E-value for the DUF4660 domain shown below is 6.3e-24.

XGRGKQAEKRLPGPDELFRSVTRPAFLYNPLNKQIDWERHVVKAPEELLPETP

DUF4660

• PFAM accession number: PF15559
• Interpro abstract (IPR029089):

  This entry represents a group of eukaryotic proteins that are typically between 93 and 189 amino acids in length.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4660