The domain within your query sequence starts at position 20 and ends at position 125; the E-value for the DUF4660 domain shown below is 2.8e-42.
SDSSDENSEPEDAGRKEAASAPTTGGRGKQAEKRLPGPDELFRSVTRPAFLYNPLNKQID WERHVVKAPEEPPKEFKIWKSNCVPPPETYTTEKKPPPPELDMAIK
DUF4660 |
 |
|---|
| PFAM accession number: | PF15559 |
|---|---|
| Interpro abstract (IPR029089): | This entry represents a group of eukaryotic proteins that are typically between 93 and 189 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4660