The domain within your query sequence starts at position 27 and ends at position 217; the E-value for the DUF4674 domain shown below is 3.9e-80.

WAYSSTHEDNSTFQETCPHCFQLLVLDNSRVRLKPKAKLTPKIQKLLNREARNDTLSFKE
AKLLRKYKDSTSVLLITCRTCNRTVRHHGKSRSFLWALKSNAATAANKASPKTPKRTAPG
SANLGQSTNGSKGKSPSLTIRTPTSGQSTPICSSRNGSKRKKHFSQLKALLSQSASDKNP
KLDFRHFLSSL

DUF4674

DUF4674
PFAM accession number:PF15719
Interpro abstract (IPR029779): This uncharacterised family includes human protein C18orf21.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4674