The domain within your query sequence starts at position 1 and ends at position 151; the E-value for the DUF4694 domain shown below is 1.2e-65.
LDKPIPLPPATKAENRGSSAWNAQEQKPNSSLPSLEVQAHVGSCHSATIQKPPKTVRSTL GTPQSTESLVKSTQSLKPEVCSISTPTSSGYEADGECSKDNLVNRKQTVRLTKRLTTRVE SSEIFPVPHLSPFKIRRLARKGQCSQKSGGE
DUF4694 |
---|
PFAM accession number: | PF15765 |
---|---|
Interpro abstract (IPR031520): | This uncharacterised family includes human protein TNT or C16orf82. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4694