The domain within your query sequence starts at position 48 and ends at position 609; the E-value for the DUF4696 domain shown below is 3.8e-224.

FPKVERRETAQEYAEKEQSQKMNTDDQENISFAPKYMLQQMSSEAPMVLSEGPSEIPLIK
VFSVNKESHLPGAGLLHPTSPGVYSSSEPVVSASEQEPGPSLLERMSSEHSLSKVMLTVA
VSSPASLNPDQEGPYNSLSTQPIVAAVTDVTHGSLDYLDNQLFAAKSQEAVSLGNSPSSS
INTKEPEIIKADAAMGTTVVPGVDSTGDMEPDRERPSEMAADDGQSTTTKYLVTIPNNFL
TTEPTAGSILGDAKVTVSVSTAGPVSSIFNEEWDDTKFESISRGRPPEPGDNAETQMRTK
PPHGTYESFEGTEESPSSTAVLKVAPGHLGGEPALGTALVTALGDERSPVLTHQISFTPM
SLAEDPEVSTMKLFPSAGGFRASTQGDRTQLSSETAFSTSQYESVPQQEAGNVLKDITQE
RKMATQAMNTTSPVVTQEHMATIEVPRGSGEPEEGMPSLSPVPAEVADAELSRRGESLAT
PASTTVVPLSLKLTSSMEDLMDTITGPSEEFIPVLGSPMAPPAMTVEAPTISSALPSEGR
TSPSISRPNTAASYGLEQLESE

DUF4696

DUF4696
PFAM accession number:PF15767
Interpro abstract (IPR031524):

This family of proteins is found in chordates. Proteins in this family are typically between 599 and 780 amino acids in length. There is a conserved AFP sequence motif.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4696