The domain within your query sequence starts at position 9 and ends at position 313; the E-value for the DUF4699 domain shown below is 2.5e-123.

IQSYLFDPVQVPSPGFVNEVNNCKLEEDDTVRLKGTQNSEVEVPRNALHDGSLSNSESRG
STTGLPHQGPLPQEDSEERPCVEKQGIVNGISPTATLQSVRSSRLHQVDNSSWASSPWVA
TIDSAHLAQPFLEGEDYRKQSCLLPTLEGTQMVGHGDCRAPAEALAVADHIPYIPAPDYP
QLWSPTVDNADPEEKDCLFENHSEVEPLPGIQPRVSQLGLNVPFSLQRSWDSLNEAGTTE
VLSDYFKEEGPTHPTPAADSGSEREDPHTYNGDREGVVVDEDAEVAEALAALEAATAGED
ADDAD

DUF4699

DUF4699
PFAM accession number:

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4699