The domain within your query sequence starts at position 20 and ends at position 136; the E-value for the DUF4703 domain shown below is 1.6e-32.
VPFWKHLGKPGTSEQHEKRPLTGPEKASMDSDTVKLVKPHKEAMVADLDAGPGMLEPCVL PSAKERSPVRDQESRSNRDSRDSRSLMTLVHSVSMFMFSMLQSGWRLFFYECWLSFL
DUF4703 |
---|
PFAM accession number: | PF15775 |
---|---|
Interpro abstract (IPR031534): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 149 and 210 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4703