The domain within your query sequence starts at position 446 and ends at position 717; the E-value for the DUF4704 domain shown below is 2.5e-109.

SPHALMLQDVKAVLTHSIQSAMHSIGGVQVLFPLFAQLDYKQYLSDEVDLTICTTLLAFI
MELLKNSIAMQEQMLACKGFLVIGYSLEKSSKSHVSRAVLELCLAFSKYLSNLQNGMPLL
KQLCDHILLNPAVWIHTPAKVQLMLYTYLSTEFIGTVNIYNTIRRVGTVLLIMHTLKYYY
WAVNPQDRSGITPKGLDGPRPNQKEILSLRAFLLMFIKQLVMKDSGVKEDELQAILNYLL
TMHEDDNLMDVLQLLVALMAEHPNSMIPAFDQ

DUF4704

DUF4704
PFAM accession number:PF15787
Interpro abstract (IPR031570):

This domain of unknown function can be found in neurobeachin proteins from eukaryotes [(PUBMED:11102458), (PUBMED:17215302)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4704