The domain within your query sequence starts at position 139 and ends at position 579; the E-value for the DUF4707 domain shown below is 4.7e-252.

PVEEPIVSTDEVIFPLTVSLDRLPPGTPKAKIVVTVWKREVEAPEVRDQGYLRLLQTRSP
GETFRGEQSAFKAQVSTLLTLLPPPVLKCRQFTVAGKHLTVLKVLNSSSQEEISIWDIRI
LPNFNASYLPVMPDGSVLLVDNVCHQSGEVSMGSFCRLPGTSGYFPCPLSALEEHNFLFQ
LRGGEQPPPGAKEGLEVPLIAVVQWSTPKLPFTQSIYTHYRLPSVRLDRPCFVMTASCES
PVRTYERFTVTYTLLNNLQDFLAVRLVWTPEHAQAGKQLCEEERRAMQAALDSIVCHTPL
NNLGFSRKGSALTFSVAFQALRTGLFELSQHMKLKLQFTASVSHPPPEARPLSRKSSPSS
PAVRDLVERHQASLGRSQSFSHQQPSRSHLMRSGSVMERRAITPPVASPVGRPLYLPPDK
AVLSLDKIAKRECKVLVVEPV

DUF4707

DUF4707
PFAM accession number:PF15806
Interpro abstract (IPR031626):

This family of proteins is found in eukaryotes. The function is not known.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4707