The domain within your query sequence starts at position 62 and ends at position 134; the E-value for the DUF4710 domain shown below is 1.6e-28.
TPSARRVHLAALPERYDSLEEPAPGDKPKKRYRRKLKKYGKNFGKAISKGCRYIVIGLQG FAAAYSAPFGVAT
DUF4710 |
---|
PFAM accession number: | PF15828 |
---|---|
Interpro abstract (IPR031667): | This family of proteins is found in eukaryotes. Proteins in this family are typically between 60 and 150 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4710