The domain within your query sequence starts at position 8 and ends at position 61; the E-value for the DUF4713 domain shown below is 6.3e-23.

ETTTSVYLGFQVQQIHPFHDNWNTACFVILLLFIMTVVSLVVLAFLYEVLDCCC

DUF4713

 DUF4713
PFAM accession number:PF15831
Interpro abstract (IPR031671):

This family of proteins is found in eukaryotes. Proteins in this family are typically between 68 and 91 amino acids in length. Members are single-pass membrane proteins described as small integral membrane proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4713