The domain within your query sequence starts at position 1 and ends at position 139; the E-value for the DUF4715 domain shown below is 7.3e-84.
MEALFQAGSILMKVNTLQGKKMVESGLQSGDLSLSQSWPSYLPLPADLEILQQKVAGVQR ELEDFKEEALKAIRYLEDAFCQMSGVLAQQEEQAARVKQRLREEEDRGIVRNKVLTFLLP REKQLREHCQRLENMLVRS
DUF4715 |
---|
PFAM accession number: | PF15835 |
---|---|
Interpro abstract (IPR031678): | This family of proteins is found in eukaryotes. Proteins in this family are approximately 150 amino acids in length. The proteins are also known as coiled-coil domain-containing protein 182 (CCDC182). |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4715