The domain within your query sequence starts at position 37 and ends at position 107; the E-value for the DUF4717 domain shown below is 7.8e-39.

LDGDKSQKDKVSSEDQGEEEYEEHFEASSEGEQWQEIDMVQQEDTISQAITLQDHLLDLA
FCFNLASIMFF

DUF4717

DUF4717
PFAM accession number:PF15838
Interpro abstract (IPR031684):

This family of proteins is found in eukaryotes. Proteins in this family are typically between 103 and 139 amino acids in length. There are two conserved sequence motifs: LLLL and CFNLAS.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4717