The domain within your query sequence starts at position 13 and ends at position 93; the E-value for the DUF4723 domain shown below is 2.1e-53.
DVGGVICKFCNLSIPFHGCVLDFGTCRTKPGQYCIKEVLIKGGIEWYSVKGCTEDKSECF KRIIKNYEIRTSHCCHRPLCN
DUF4723 |
 |
|---|
| PFAM accession number: | PF15851 |
|---|---|
| Interpro abstract (IPR031710): | This family of proteins is found in mammals. There are a number of conserved cysteines but it is unlikely to be a zinc-finger family. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4723