The domain within your query sequence starts at position 56 and ends at position 334; the E-value for the DUF4735 domain shown below is 2.4e-101.

DGVVGFQVLEVQLRGVQEKWAHKPLLQPLSMRAGQMANTLSALLQKSIFYLKQSDPTYLR
EFQPSIQPGFWKLPNDWTRTNASLVYPWLEPLDSFSEESSDVCLVQLLGTGTDSSQPCRL
SNFCRTLMTKAGCSGYSLSHQLLFFLWARMQGCTEGLFLQSQHYMDIFCANMMELNHRAE
AVGYAYPTQDLFMENIMFCGMAGFSDFYKLRWLEAILSWQNPQVGCFGRPDTKGEPSEVP
HQQGILRRVRRREKLFADGCSCHNTATAVAALGGFLYIL

DUF4735

DUF4735
PFAM accession number:PF15882
Interpro abstract (IPR031751):

This family of proteins is found in eukaryotes and includes human C16orf89, which is thyroid-specific [(PUBMED:20578903)]. Proteins in this family are typically between 288 and 410 amino acids in length. There are two completely conserved C residues that may be functionally important.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4735