The domain within your query sequence starts at position 59 and ends at position 187; the E-value for the DUF4745 domain shown below is 1.3e-57.
AAGSCHHAMPHSTPIADIQQGISKYLDALNVFCRASTFLTDLFSTVFRNSHYSKAAMQLK DVQEHVMEAASRLTSAIKPEIAKMLMELSAGAANFTDQKEFSLQDIEVLGRCFLTVVQVH FQFLTHALQ
DUF4745 |
---|
PFAM accession number: | PF15923 |
---|---|
Interpro abstract (IPR031813): | This presumed domain is functionally uncharacterised. It is found in eukaryotes. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4745