The domain within your query sequence starts at position 71 and ends at position 121; the E-value for the DUF4748 domain shown below is 2.9e-23.

PMKAVGLAWAIGFPCGILFFVLTKQEVDKDRLKQMKARQNMRVSNTGEYSL

DUF4748

 DUF4748
PFAM accession number:PF15932
Interpro abstract (IPR031833):

This family of proteins is functionally uncharacterised and is found in eukaryotes.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4748