The domain within your query sequence starts at position 37 and ends at position 125; the E-value for the DUF4795 domain shown below is 1.1e-20.
GKFTLVQSDLNSLKKDIEEVWKVVRKLLLEGLRFDPDSAAGFKKKLFERVKCISCDRPVE MMTGPQLITIRNTHGLSRIRPASANSYEY
DUF4795 |
 |
|---|
| PFAM accession number: | PF16043 |
|---|---|
| Interpro abstract (IPR032013): | This family of proteins is functionally uncharacterised. This family of proteins is found in eukaryotes. Proteins in this family are typically between 285 and 978 amino acids in length. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4795