The domain within your query sequence starts at position 1037 and ends at position 1085; the E-value for the DUF4801 domain shown below is 1e-19.

IRKRAPPCNNDFCRLGCVCSSLALEKRQPAHCRRPDCMFGCTCLKRKVV

DUF4801

DUF4801
PFAM accession number:PF16059
Interpro abstract (IPR032060):

This presumed domain is functionally uncharacterised. This domain can be found in the MAX gene-associated protein (Mga), which is a dual-specificity transcription factor that contains both a bHLHZip domain and a T-box domain and is able to bind to and regulate transcriptional targets through both E-box sites as well as T-box-binding elements (TBEs) [(PUBMED:25516968)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4801