The domain within your query sequence starts at position 146 and ends at position 204; the E-value for the DUF4808 domain shown below is 4.7e-10.

QLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGL

DUF4808

DUF4808
PFAM accession number:PF16066
Interpro abstract (IPR032073):

This domain is found in fibronectin type III domain-containing protein 5 (FNDC5). FNDC5 is cleaved into Irisin, a putative myokin that stimulates white-to-brown fat conversion in mice [(PUBMED:22237023)], though this role is disputed in humans [(PUBMED:24781257), (PUBMED:26212086)]. This domain is found C-terminal to the irisin domain [(PUBMED:24114836)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4808