The domain within your query sequence starts at position 146 and ends at position 204; the E-value for the DUF4808 domain shown below is 4.7e-10.

QLRTGEVLIIVVVLFMWAGVIALFCRQYDIIKDNEPNNNKEKTKSASETSTPEHQGGGL

DUF4808

• PFAM accession number: PF16066
• Interpro abstract (IPR032073):

  This domain is found in fibronectin type III domain-containing protein 5 (FNDC5). FNDC5 is cleaved into Irisin, a putative myokin that stimulates white-to-brown fat conversion in mice [ (PUBMED:22237023) ], though this role is disputed in humans [ (PUBMED:24781257) (PUBMED:26212086) ]. This domain is found C-terminal to the irisin domain [ (PUBMED:24114836) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4808