The domain within your query sequence starts at position 249 and ends at position 346; the E-value for the DUF4819 domain shown below is 1.8e-23.

VDVVLDVTPPPGALMVGTAVCTCVEPGVAAYREGVVVEVATKPAAYKVRLSPGPSSHAGP
PGTLPQAQQTLHREPEEAVWVTRSSLRLLRPPWEPGAL

DUF4819

DUF4819
PFAM accession number:PF16090
Interpro abstract (IPR032147):

This presumed domain is functionally uncharacterised. It is found in a subset of transcriptional repressor capicua proteins [(PUBMED:17190598), (PUBMED:25059278)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4819