The domain within your query sequence starts at position 15 and ends at position 272; the E-value for the DUF4821 domain shown below is 1.1e-96.

HCRRTESQDIFCIKNLVRKFTQKLFGRLNIIYLLEKANLAVTVCNDKEEIMAHSIFLDYP
NWNVAKQDNWIPLFRELDKEIPCTPLNTLFMHFFVAVDEYATGCLKEIIRTVFKAVPELY
FIFLIVPTYLSLGSTLITVFDQVGNIPCLNYNEDFAVHICHRHNHYPQLHIRKARVEDHD
DLMPIFMHYDNTLKEIYGEYFLAELIEAQDKDHHAVVCEVEGKAVGFMSVCTSVNLPLLH
ECFDLGPFHGFCTPHPDD

DUF4821

DUF4821
PFAM accession number:PF16092
Interpro abstract (IPR032151): This entry represents the N-terminal domain of proteins described as cilia- and flagella-associated protein. Proteins containing this domain includes FAP61 from Chlamydomonas reinhardtii. FAP61 is part of the calmodulin and spoke-associated complex (CSC) required for wild-type motility and for the stable assembly of a subset of radial spokes in motile cilia [(PUBMED:25694453)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4821