The domain within your query sequence starts at position 731 and ends at position 816; the E-value for the DUF4927 domain shown below is 2.7e-33.

KQEPASPKKKENALLRYLLDKDDTKDIGLPEITPKLERLDSKTDPASNTKLIAMKTVKEE
VSFEPSDQPGSELDNLEEILDDLQNS

DUF4927

DUF4927
PFAM accession number:PF16279
Interpro abstract (IPR032565):

This entry represents a domain found in nuclear receptor coactivators, which are ligand-dependent transcription factors [(PUBMED:10713439)]. These receptors can function as molecular switches [(PUBMED:10713439)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4927