The domain within your query sequence starts at position 130 and ends at position 220; the E-value for the DUF4939 domain shown below is 6.1e-17.
DDDCLEDLPEKFDGNPDMLGPFMYQCQLFMEKSTRDFSVDRIRVCFVTSMLIGRAARWAT AKLQRCTYLMHNYTAFMMELKHVFEDPQRRE
DUF4939 |
---|
PFAM accession number: | PF16297 |
---|---|
Interpro abstract (IPR032549): | This domain is found in some members of the Mart (mammalian retrotransposon-derived) family, including LDOC1/Mart7, LDOC1L/Mart6, RTL1/Mart1, PEG10/Mart2, FAM127/Cxx1/Mart8, ZCCHC5/Mart3 and RGAG4/Mart5 [ (PUBMED:16155747) (PUBMED:25888968) ]. Its function is not known. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4939