The domain within your query sequence starts at position 24 and ends at position 353; the E-value for the DUF4962 domain shown below is 5.2e-11.

ITDENPEVMIPFTNANYDSHPMLYFSRKDVAELQLRAASSHEHIAARLTEAVHTMLTNPL
EYLPPWDPKEYSARWNEIYGNNLGALAMFCVLYPENTEARDMAKDYMERMAAQPSWLVKD
APWDEVPLAHSLVGFATAYDFLYNYLSKTQQETFLEVIANASGYMYETSYRRGWGFQYLH
NHQPTNCMALLTGSLILMNQGYLQEAYLWTKQVLSIMEKSLVLLREVTDGSLYEGVAYGS
YTTRSLFQYMFLVQRHFDINHFGHPWLKQHFAFMYRTILPGFQRTVAIADSNYNWFYGPE
SQLVFLDKFVMRNGSGNWLADQIRRNRVVE

DUF4962

DUF4962
PFAM accession number:PF16332
Interpro abstract (IPR032518): This domain can be found in the N terminus of dermatan-sulfate epimerase from mammals, and heparin and heparin-sulfate lyase (also known as heparinase II) from bacteria [(PUBMED:20404324)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF4962