The domain within your query sequence starts at position 77 and ends at position 128; the E-value for the DUF504 domain shown below is 1.9e-11.

VGYTDRFLGVQEEPFCAFCWDEPLAALGPGVLAVPQHRIRYFRFRGRLVWDR

DUF504

DUF504
PFAM accession number:PF04457
Interpro abstract (IPR007547): This is a family of uncharacterised proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF504