The domain within your query sequence starts at position 245 and ends at position 472; the E-value for the DUF563 domain shown below is 1.3e-31.

NMYHHFCDFLNLYLTQHVNNSFSTDVYIVMWDTSTYGYGDLFSDTWKAFTDYDVIHLKTY
DSKKVCFKEAVFSLLPRMRYGLFYNTPLISGCQNTGLFRAFSQHVLHRLNITQEGPKDGK
VRVTILARSTEYRKILNQDELVNALKTVSTFEVRVVDYKYRELGFLDQLRITHNTDIFIG
MHGAGLTHLLFLPDWAAVFELYNCEDERCYLDLARLRGIHYITWRKPS

DUF563

DUF563
PFAM accession number:PF04577
Interpro abstract (IPR007657):

Glycosyltransferase 61 family members are further processed into a mature form. Proteins in this family includes O-linked-mannose beta-1,4-N-acetylglucosaminyltransferase 2 (POMGnT2, also known as EOGTL) [(PUBMED:23929950)] and EGF domain-specific O-linked N-acetylglucosamine transferase (EOGT) [(PUBMED:23671640)].

This entry also includes plant beta-(1,2)-xylosyltransferase [(PUBMED:10781814)].

GO function:transferase activity, transferring glycosyl groups (GO:0016757)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF563