The domain within your query sequence starts at position 1 and ends at position 68; the E-value for the DUF572 domain shown below is 1.4e-31.

MGERKGQNKYYPPDFNPEKHGSLNRYHNSHPLRERARKLSQGILVIRFEMPYNIWCDGCK
NHIGMGER

DUF572

DUF572
PFAM accession number:PF04502
Interpro abstract (IPR007590): This entry includes CCDC130 and CCDC94 from humans, Cwf16 from fission yeasts and Yju2 from budding yeasts. Cwf16 is involved in mRNA splicing where it associates with cdc5 and the other cwf proteins as part of the spliceosome [(PUBMED:11884590)]. Yju2 is a splicing factor that is associated with the Prp19-associated complex and acts after Prp2 in promoting the first catalytic reaction of pre-mRNA splicing [(PUBMED:17515604)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF572