The domain within your query sequence starts at position 1 and ends at position 64; the E-value for the DUF647 domain shown below is 4.6e-25.

RIIFAWWKGSKLDCNAKQWRLFADILNDVAMFLEIMAPMYPIFFTMTVSTSNLAKVATSG
TLLY

DUF647

DUF647
PFAM accession number:PF04884
Interpro abstract (IPR006968):

This family is composed of root UVB sensitive proteins and their homologues. In Arabidopsis thaliana, proteins in this family are involved in UVB-sensing and in early seedling morphogenesis and development [ (PUBMED:19075229) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF647