The domain within your query sequence starts at position 62 and ends at position 301; the E-value for the DUF647 domain shown below is 5.6e-97.

WAALTALSGLRSVLLPQGFPDSVSPDYLPYQLWDSVQAFASSLSGSLATQAVLQGLGVGN
AKASVSAATSTWLVKDSTGMLGRIIFAWWKGSKLDCNAKQWRLFADILNDVAMFLEIMAP
MYPIFFTMTVSTSNLAKCIVGVAGGATRAALTMHQARRNNMADVSAKDSSQETVVNLAGL
LVSLLMLPLVSDCPSLSLGCFVLLTALHIYANYRAVRALVLETLNESRLQLVLEHFLQRG

DUF647

DUF647
PFAM accession number:PF04884
Interpro abstract (IPR006968): This family is composed of root UVB sensitive proteins and their homologues. In Arabidopsis thaliana, proteins in this family are involved in UVB-sensing and in early seedling morphogenesis and development [(PUBMED:19075229)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF647