The domain within your query sequence starts at position 60 and ends at position 183; the E-value for the DUF667 domain shown below is 5e-26.

SAAWQHPFLNVFRHFRVDEWKRSSKEGDVAVVTDKVLKSAVYRIRGSVSASNYIQLPRTS
TQSLGLTGRYLYVLFRPVPTKHFVIHLDVSTEDGQVIRVSFSNLFKEFKSSTTWLQFPFV
FETK

DUF667

DUF667
PFAM accession number:PF05018
Interpro abstract (IPR007714): This entry includes cilia- and flagella-associated protein 20 (CFA20), WD repeat-containing protein 90 (WDR90) and uncharacterised human protein C3orf67. CFA20 is a cilium- and flagellum-specific protein that plays a role in axonemal structure organisation and motility [(PUBMED:20118210), (PUBMED:24574454)]. In Chlamydomonas reinhardtii, it stabilises outer doublet microtubules (DMTs) of the axoneme and may work as a scaffold for intratubular proteins, such as tektin and PACRG, to produce the beak structures in DMT1 [(PUBMED:24259666), (PUBMED:24574454)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF667