The domain within your query sequence starts at position 1235 and ends at position 1431; the E-value for the DUF676 domain shown below is 9e-65.

SEDGVHLIVCVHGLDGNSADLRLVKTYIELGLPGGRVDFLMSERNQNDTFADFDCMTDRL
LDEIIQYIQIYSLTVSKISFIGHSLGNLIIRSVLTRPRFKYYLSKLHTFLSLSGPHLGTL
YNSSALVNTGLWFMQKWKKSGSLLQLTCRDHSDPRQTFLYKLSNKAGLHYFKNVVLVGSL
QDRYVPYHSARIEMCKT

DUF676

DUF676
PFAM accession number:PF05057
Interpro abstract (IPR007751):

This domain, whose function is unknown, is found within a group of putative lipases. Proteins containing this domain include YOR059C (Lpl1) from budding yeasts. Lpl1 has been identified as a phospholipase B [(PUBMED:25014274)].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF676