The domain within your query sequence starts at position 71 and ends at position 195; the E-value for the DUF716 domain shown below is 6.1e-36.

RCVVLEQCAQALSMYLFLPLMVSHMQDTEGVELQLHMLLIQAMFLLALVETIELWAPNVL
LIWMLKAFLYVVTGSWLMQIGFMLYKPISGYKWLDEDKNDVAFATTFFCWHVVSGAFLMI
SAYGV

DUF716

DUF716
PFAM accession number:PF04819
Interpro abstract (IPR006904):

These sequences are a family of uncharacterised hypothetical proteins restricted to eukaryotes. Q9SLW7 represents a sequence from Nicotiana tabacum (Common tobacco) which is up regulated in response to TMV infection.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF716