The domain within your query sequence starts at position 27 and ends at position 114; the E-value for the DUF758 domain shown below is 9e-45.

TDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAERVI
KNLIKTVIKLAVLHRNNQFNQDELALME

DUF758

DUF758
PFAM accession number:PF05527
Interpro abstract (IPR008477): Four tumor necrosis factor alpha-induced protein 8-like proteins have been identified: TNFAIP8 (also known as TIPE), TIPE1, TIPE2 and TIPE3. Overexpressed TIPE in cells can reduce cell death in vitro and increase tumor growth in vivo [(PUBMED:10644768)]. By contrast, TIPE2 has been demonstrated to be an inhibitor of Ras and to have a pro-apoptotic ability. TIPE1 could upregulate the pro-apoptotic members of the B-cell leukemia/lymphoma (Bcl)-2 family of proteins [(PUBMED:27900028)].
GO process:regulation of apoptotic process (GO:0042981)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF758