The domain within your query sequence starts at position 27 and ends at position 212; the E-value for the DUF758 domain shown below is 6.5e-98.
TDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTKEYTQNKKEAERVI KNLIKTVIKLAVLHRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVEYTFDRNVLSRLL NECRELLHEIIQRHLTAKSHGRVNNVFDHFSDCDFLAALYNPFGKFKPHLQKLCDGINKM LDEENI
DUF758 |
---|
PFAM accession number: | PF05527 |
---|---|
Interpro abstract (IPR008477): | Four tumor necrosis factor alpha-induced protein 8-like proteins have been identified: TNFAIP8 (also known as TIPE), TIPE1, TIPE2 and TIPE3. Overexpressed TIPE in cells can reduce cell death in vitro and increase tumor growth in vivo [ (PUBMED:10644768) ]. By contrast, TIPE2 has been demonstrated to be an inhibitor of Ras and to have a pro-apoptotic ability. TIPE1 could upregulate the pro-apoptotic members of the B-cell leukemia/lymphoma (Bcl)-2 family of proteins [ (PUBMED:27900028) ]. |
GO process: | regulation of apoptotic process (GO:0042981) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF758