The domain within your query sequence starts at position 3 and ends at position 295; the E-value for the DUF766 domain shown below is 2.3e-145.

CLGLYCGKTLLFKNGSSEIYGECGVCPRGQRTNAQKYCQPCTESPELYDWLYLGFMAMLP
LVLHWFFIEWYSGKKSSSALFQHITALFECTMAAIITLLVSDPVGVLYIRSCRVLMLSDW
YTMLYNPSPDYVTTVHCTHEAVYPLYTIVFVYYAFCLVLMMLLRPLLVKKIACGLGKSDR
FKSIYAALYFFPILTVLQAVGGGLLYYAFPYIILVLSLVTLAVYMSASEIENCYDLLVRK
KRLIVLFSHWLLHAYGIVSISRVDRLEHDLPLLALVPTPALFYLFTAKFTEPS

DUF766

DUF766
PFAM accession number:PF05571
Interpro abstract (IPR008485): JAMP is a Jun N-terminal kinase 1 (JNK1)-associated membrane protein. It associates with JNK1 through its C-terminal domain and regulates the duration of JNK1 activity in response to diverse stress stimuli [(PUBMED:16166642)]. It is an important component for coordinated clearance of misfolded proteins from the ER [(PUBMED:18784250), (PUBMED:19269966)].
GO process:response to unfolded protein (GO:0006986)
GO component:integral component of membrane (GO:0016021)

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF766