The domain within your query sequence starts at position 1 and ends at position 89; the E-value for the DUF775 domain shown below is 3e-34.

MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYENINHVVVFMLGTIPFPEGMGGSVYFSYPD
SNGVPVWQLLGFVTNGKPSAIFKISGLKS

DUF775

DUF775
PFAM accession number:PF05603
Interpro abstract (IPR008493):

The function of the DUF775 domain is not clear.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF775