The domain within your query sequence starts at position 1 and ends at position 89; the E-value for the DUF775 domain shown below is 3e-34.
MFGCLVAGRLVQTAAQQVAEDKFVFDLPDYENINHVVVFMLGTIPFPEGMGGSVYFSYPD SNGVPVWQLLGFVTNGKPSAIFKISGLKS
DUF775 |
![]() |
---|
PFAM accession number: | PF05603 |
---|---|
Interpro abstract (IPR008493): | The function of the DUF775 domain is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF775