The domain within your query sequence starts at position 2 and ends at position 96; the E-value for the DUF775 domain shown below is 9.3e-24.
NIVRTPSVAQIGISVELLDSLAQQTPVGSAAVSSVDSFTQFTQKMLDNFYNFASSFALSQ AQMTPNPSEMFIPANVVLKWYENFQRRLAQNPLFW
DUF775 |
 |
|---|
| PFAM accession number: | PF05603 |
|---|---|
| Interpro abstract (IPR008493): | The function of the DUF775 domain is not clear. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF775