The domain within your query sequence starts at position 112 and ends at position 178; the E-value for the DUF778 domain shown below is 3.2e-22.
QVYASGPNAWDTAVHDASEEYKHRMHNLCCDNCHSHVALALNLMRYNNSTNWNMVTLCCF CLIYGKY
DUF778 |
---|
PFAM accession number: | PF05608 |
---|---|
Interpro abstract (IPR008496): | This entry includes TMEM222 from animals and RTE1 (REVERSION-TO-ETHYLENE SENSITIVITY1) from Arabidopsis. RTE1 is positive regulator of the ETR1 ethylene receptor [ (PUBMED:18643990) (PUBMED:16682642) ]. This entry also includes Arabidopsis RTE1 homologue, RTH, which acts via RTE1 in regulating ethylene responses and signaling [ (PUBMED:28541511) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF778