The domain within your query sequence starts at position 26 and ends at position 66; the E-value for the DUF778 domain shown below is 2.7e-16.

IPVLTWFFPIIGHMGICTSAGVIRDFAGPYFVSDRPGGQCG

DUF778

DUF778
PFAM accession number:PF05608
Interpro abstract (IPR008496):

This entry includes TMEM222 from animals and RTE1 (REVERSION-TO-ETHYLENE SENSITIVITY1) from Arabidopsis. RTE1 is positive regulator of the ETR1 ethylene receptor [ (PUBMED:18643990) (PUBMED:16682642) ]. This entry also includes Arabidopsis RTE1 homologue, RTH, which acts via RTE1 in regulating ethylene responses and signaling [ (PUBMED:28541511) ].

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF778