The domain within your query sequence starts at position 61 and ends at position 118; the E-value for the DUF778 domain shown below is 4.4e-28.

IPVLTWFFPIIGHMGICTSAGVIRDFAGPYFVSEDNMAFGKPAKFWKLDPGQVYASGP

DUF778

DUF778
PFAM accession number:PF05608
Interpro abstract (IPR008496): This family consists of several eukaryotic proteins of unknown function.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF778