The domain within your query sequence starts at position 7 and ends at position 103; the E-value for the DUF788 domain shown below is 4.2e-30.

VGTRGKKQIFEENKETLKFYLRIILGANAIYCLVTLVFFYSSASFWAWMALGFSLAVYGA
SYHSMSSMARASFSEDGSLMDGGMDLNMEQGMAELQA

DUF788

DUF788
PFAM accession number:PF05620
Interpro abstract (IPR008506):

This family includes SRP-independent targeting protein 2 (SND2) from yeast and transmembrane protein 208 (TMEM208) from mammals. Both are localized to the endoplasmic reticulum (ER) [(PUBMED:27905431), (PUBMED:23691174)]. SND2 works together with SND1 and SND3 in an alternative targeting route to the ER [(PUBMED:27905431)]. TMEM208 regulates both ER stress and autophagy [(PUBMED:23691174)].

SND2 was previously known as Env10 in Saccharomyces cerevisiae, and its homologue as Mug69 in Schizosaccharomyces pombe. They were identified as proteins involved in vacuolar processing and morphology [(PUBMED:21912603)] and meiosis [(PUBMED:16303567)], respectively.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF788