The domain within your query sequence starts at position 8 and ends at position 100; the E-value for the DUF814 domain shown below is 2.2e-31.

SSVNSSTYTIYMGKDKYENEDLIKYGWPEDIWFHVDKLSSAHVYLRLQKGEKIEDIPKEV
LMDCAHLVKANSIQGCKMNNVNVVYTPWSNLKK

DUF814

DUF814
PFAM accession number:PF05670
Interpro abstract (IPR008532): This domain can be found at the N terminus of the coiled-coil domain-containing protein 25 (CCDC25) and at the middle of the nuclear export mediator factor NEMF. The function of this domain is not clear. This domain contains a conserved motif D/E-X-W/Y-X-H that may be functionally important.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF814