The domain within your query sequence starts at position 3 and ends at position 105; the E-value for the DUF815 domain shown below is 4.8e-8.

AAAPSQQRPAAARARNLPWVEKYRPQTLADLISHQDILSTIQKFISEDRLPHLLLYGPPG
TGKTSTILACAKQLYKDKEFGSMVLEVKETLSLHNSSDLQTLN

DUF815

DUF815
PFAM accession number:PF05673
Interpro abstract (IPR008533): This domain consists of several bacterial proteins of unknown function.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF815