The domain within your query sequence starts at position 19 and ends at position 252; the E-value for the DUF829 domain shown below is 5.3e-61.

PVVILLGWGGCRDKNLAKYSAIYHKRGCIVIRYTAPWHMVFFSESLGIPSLRVIAQKLLE
LLFDYEIEREPLLFHVFSNAGVMLYRYVLELLQTHQRFRHLHVVGTIFDSGPGDSNLIGA
LRALATILERRPAVLRLLLLAAFALVVILFHFLLAPFTALFHTHFYDRLQDSGSCWPELY
LYSRADKVVSARDVERMVEARLAHQVMVRGVDFVSSAHVSHLRDYPTYYTSLCV

DUF829

DUF829
PFAM accession number:PF05705
Interpro abstract (IPR008547): This signature identifies Transmembrane protein 53, that have no known function but are predicted to be integral membrane proteins.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF829