The domain within your query sequence starts at position 5 and ends at position 84; the E-value for the DUF842 domain shown below is 4.4e-26.
QQLRVQEAVDAMVKSVERENIRKMQGLMFRCSANCCEDTQASMQQVHQCIERCHAPLAQA QALVTSELERFQVRNASQLP
DUF842 |
---|
PFAM accession number: | PF05811 |
---|---|
Interpro abstract (IPR008560): | This family consists of a number of conserved eukaryotic proteins of unknown function. The sequences carry three sets of CxxxC motifs, which might suggest a type of zinc-finger formation. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF842