The domain within your query sequence starts at position 5 and ends at position 84; the E-value for the DUF842 domain shown below is 4.4e-26.

QQLRVQEAVDAMVKSVERENIRKMQGLMFRCSANCCEDTQASMQQVHQCIERCHAPLAQA
QALVTSELERFQVRNASQLP

DUF842

DUF842
PFAM accession number:PF05811
Interpro abstract (IPR008560):

This family consists of a number of conserved eukaryotic proteins of unknown function. The sequences carry three sets of CxxxC motifs, which might suggest a type of zinc-finger formation.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF842