The domain within your query sequence starts at position 32 and ends at position 174; the E-value for the DUF846 domain shown below is 9.5e-58.
RHPVASFFHLFFRVSAVVVYLLCELLSSSFIACMVTIILLLSCDFWAVKNVTGRLMVGLR WWNHIDEDGKSHWVFESRKSTPQDNKTISEAESRIFWLGLIACPVLWVIFAFSALFSFRV KWLAVVIMGVVLQGANLYGYIRC
DUF846 |
---|
PFAM accession number: | PF05832 |
---|---|
Interpro abstract (IPR008564): | Tvp23 is a Golgi membrane protein involved in vesicular trafficking [ (PUBMED:21512130) ]. |
GO component: | integral component of membrane (GO:0016021) |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF846