The domain within your query sequence starts at position 1 and ends at position 138; the E-value for the DUF866 domain shown below is 2.7e-62.
MGKIALQLKATLENVTNLRPVGEDFRWYLKMKCGNCGEISEKWQYIRLMDSVALKGGRGS ASMVQKCKLCARENSIDILSSTIKAYNAEDNEKFKTIVEFECRGLEPVDFQPQAGFAADG VESGTVFSDINLQEKVRL
DUF866 |
---|
PFAM accession number: | PF05907 |
---|---|
Interpro abstract (IPR008584): | This family consists of a number of eukaryotic proteins including CXXC motif containing zinc binding protein (previously known as UPF0587 protein C1orf123). The crystal structure reveals that the protein binds a Zn2+ ion in a tetrahedral coordination with four Cys residues from two CxxC motifs. CXXC motif containing zinc binding protein was initially identified as an interaction partner for the heavy metal-associated (HMA) domain of CCS (copper chaperone for superoxide dismutase). However, it was shown that only misfolded mutant forms, lacking part of the zinc-binding sites, interact with CCS [ (PUBMED:30260988) ]. |
This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF866