The domain within your query sequence starts at position 2 and ends at position 66; the E-value for the DUF866 domain shown below is 4.2e-27.

EGKIALQLKATLENVTNLRPVGEDFRWYLKMKCGNCGEISEKWQYIRLMDSVALKGGRGS
ASMVQ

DUF866

DUF866
PFAM accession number:PF05907
Interpro abstract (IPR008584): This family consists of a number of hypothetical eukaryotic proteins of unknown function with an average length of around 165 residues.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF866