The domain within your query sequence starts at position 40 and ends at position 194; the E-value for the DUF866 domain shown below is 2.2e-61.

IALQLKATLENVTNLRPVGEDFRWYLKMKCGNCGEISEKWQYIRLMDSVALKGGRGSASM
VQKCKLCARENSIDILSSTIKAYNAEDNEKFKTIVEFECRGLEPVDFQPQAGFAADGVES
GTVFSDINLQEKDWTDYDEKAQESVGIFEVTHQFV

DUF866

DUF866
PFAM accession number:PF05907
Interpro abstract (IPR008584): This family consists of a number of hypothetical eukaryotic proteins of unknown function with an average length of around 165 residues.

This is a PFAM domain. For full annotation and more information, please see the PFAM entry DUF866